Iright
BRAND / VENDOR: Proteintech

Proteintech, 12622-1-AP, RFX2 Polyclonal antibody

CATALOG NUMBER: 12622-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RFX2 (12622-1-AP) by Proteintech is a Polyclonal antibody targeting RFX2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 12622-1-AP targets RFX2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: THP-1 cells Positive IP detected in: THP-1 cells Positive IHC detected in: rat testis tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RFX2 is a key regulator of ciliogenesis in vertebrates, and knockdown of Rfx2 causes defects in neural tube closure and in left-right axis patterning (PMID: 26248850). RFX2 expression is greatly enhanced in adult testis and that RFX2 is equally prominent in highly enriched populations of late pachytene spermatocytes and round spermatids(PMID: 22227339). RFX2 is also required for the development of left-right asymmetry, and motile cilia on RFX2-expressing cells are sufficient to establish adequate fluid flow across the COA to direct normal LR development in mouse (PMID: 22233545). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3310 Product name: Recombinant human RFX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 424-723 aa of BC028579 Sequence: VLPKDKLISLCQCDPILRWMRSCDHILYQALVEILIPDVLRPVPSTLTQAIRNFAKSLEGWLTNAMSDFPQQVIQTKVGVVSAFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQCEESVVQRLEQDFKLTLQQQSSLDQWASWLDSVVTQVLKQHAGSPSFPKAAQQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLYDEYMFYLVEHRVAEATGETPIAVMGEFNDLASLSLTLLDKDDMGDEQRGSEAGPDARSLGEPLVKRERSDPNHSLQGI Predict reactive species Full Name: regulatory factor X, 2 (influences HLA class II expression) Calculated Molecular Weight: 723 aa, 80 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC028579 Gene Symbol: RFX2 Gene ID (NCBI): 5990 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P48378 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924