Proteintech, 12649-1-AP, TCIRG1 Polyclonal antibody

Size: 20ul / 150ul The TCIRG1 (12649-1-AP) by Proteintech is a Polyclonal antibody targeting TCIRG1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 12649-1-AP targets TCIRG1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, U-937 cells, A431 cells, HuH-7 cells, SKOV-3 cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:10-1:100 Background Information TCIRG1, also known as V ATPase 116 kDa isoform a3, TIRC7, OPTB1, belongs to the V-ATPase 116 kDa subunit family, TCIRG1 seems to be directly involved in T-cell activation (PubMed:10329006). Alternative splicing results in multiple transcript variants. Isoform long is highly expressed in osteoclastomas. Isoform short is highly expressed in thymus (PMID: 15809087, 24753205). Mutations in TCIRG1 are associated with Osteopetrosis, autosomal recessive 1 (OPTB1)( PMID: 11532986). Specification Tested Reactivity: human Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3378 Product name: Recombinant human TCIRG1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-395 aa of BC018133 Sequence: CVSRLGELGLVEFRDLNASVSAFQRRFVVDVRRCEELEKTFTFLQEEVRRAGLVLPPPKGRLPAPPPRDLLRIQEETERLAQELRDVRGNQQALRAQLHQLQLHAAVLRQGHEPQLAAAHTDGASERTPLLQAPGGPHQDLRVNFVAGAVEPHKAPALERLLWRACRGFLIASFRELEQPLEHPVTGEPATWMTFLISYWGEQIGQKIRKITDCFHCHVFPFLQQEEARLGALQQLQQQSQELQEVLGETERFLSQVLGRVLQLLPPGQVQVHKMKAVYLALNQCSVSTTHKCLIAEAWCSVRDLPALQEALRDSSMEEGVSAVAHRIPCRDMPPTLIRTNRFTASFQGIVDAYGVGRYQEVNPAPYTIIT Predict reactive species Full Name: T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 subunit A3 Calculated Molecular Weight: 830 aa, 93 kDa Observed Molecular Weight: 92 kDa, 65-70 kDa GenBank Accession Number: BC018133 Gene Symbol: TCIRG1 Gene ID (NCBI): 10312 RRID: AB_10644329 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13488 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.