Proteintech, 12651-1-AP, SIAH2 Polyclonal antibody

Size: 20ul / 150ul The SIAH2 (12651-1-AP) by Proteintech is a Polyclonal antibody targeting SIAH2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12651-1-AP targets SIAH2 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: MCF-7 cells, mouse brain tissue, MDA-MB-231 cells Positive IP detected in: MCF-7 cells Positive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: PC-12 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information The mammalian Seven-in-absentia homolog 2 (SIAH2), is a RING finger type ubiquitin ligase with a catalytic RING domain on its N-terminus, followed by two zinc fingers and a C-terminal substrate binding domain. Siah is a mammalian homolog of Sina, a Drosophila protein functioning in eye development. Mammals express two isoforms, Siah1 and 2, and mice exhibit two Siah1 isotypes, 1a and 1b. SIAH2 indirectly regulates the level of HIF-1α by promoting degradation of PHDs by UPS. SIAH2, in turn, is positively regulated by hypoxia-dependent transcriptional and posttranscriptional mechanisms. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3342 Product name: Recombinant human SIAH2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-324 aa of BC013082 Sequence: MSRPSSTGPSANKPCSKQPPPQPQHTPSPAAPPAAATISAAGPGSSAVPAAAAVISGPGGGGGAGPVSPQHHELTSLFECPVCFDYVLPPILQCQAGHLVCNQCRQKLSCCPTCRGALTPSIRNLAMEKVASAVLFPCKYATTGCSLTLHHTEKPEHEDICEYRPYSCPCPGASCKWQGSLEAVMSHLMHAHKSITTLQGEDIVFLATDINLPGAVDWVMMQSCFGHHFMLVLEKQEKYEGHQQFFAIVLLIGTRKQAENFAYRLELNGNRRRLTWEATPRSIHDGVAAAIMNSDCLVFDTAIAHLFADNGNLGINVTISTCCP Predict reactive species Full Name: seven in absentia homolog 2 (Drosophila) Calculated Molecular Weight: 324 aa, 35 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: BC013082 Gene Symbol: SIAH2 Gene ID (NCBI): 6478 RRID: AB_2877868 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43255 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.