Proteintech, 12717-1-AP, PMP2 Polyclonal antibody

Size: 20ul / 150ul The PMP2 (12717-1-AP) by Proteintech is a Polyclonal antibody targeting PMP2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples 12717-1-AP targets PMP2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: pig spinal cord tissue, human brain tissue, mouse testis tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information PMP2 (peripheral myelin protein-2, also known as P2) is one of the major proteins of peripheral myelin and appears to be related to the transport of fatty acids or the metabolism of myelin lipids.P2 constitutes up to 15% of total protein of peripheral nervous system (PNS) myelin. It is also present in small amounts in central nervous system (CNS) myelin, being abundant in spinal cord and brain stem myelin. As a structural protein, P2 is thought to stabilize the myelin membranes. Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3411 Product name: Recombinant human PMP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of BC034997 Sequence: MSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV Predict reactive species Full Name: peripheral myelin protein 2 Calculated Molecular Weight: 132 aa, 15 kDa Observed Molecular Weight: 15-20 kDa GenBank Accession Number: BC034997 Gene Symbol: PMP2 Gene ID (NCBI): 5375 RRID: AB_2166978 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P02689 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.