Proteintech, 12738-1-AP, Collagen Type XXV Polyclonal antibody

Size: 20ul / 150ul The Collagen Type XXV (12738-1-AP) by Proteintech is a Polyclonal antibody targeting Collagen Type XXV in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 12738-1-AP targets Collagen Type XXV in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Positive IF/ICC detected in: HeLa cells, Neuro-2a cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Collagen alpha-1(XXV) chain is a protein that in humans is encoded by the COL25A1 gene. COL25A1 is a brain-specific membrane-bound collagen. Proteolytic processing releases CLAC, a soluble form of COL25A1 containing the extracellular collagen domains that associates with senile plaques in Alzheimer disease brains.(PMID: 11927537) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3634 Product name: Recombinant human COL25A1 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 165-497 aa of BC036669 Sequence: GPLGPPGQKGSIGAPGIPGMNGQKGEPGLPGAVGQNGIPGPKGEPGEQGEKGDAGENGPKGDTGEKGDPGSSAAGIKGEPGESGRPGQKGEPGLPGLPGLPGIKGEPGFIGPQGEPGLPGLPGTKGERGEAGPPGRGERGEPGAPGPKGKQGESGTRGPKGSKGDRGEKGDSGAQGPRGPPGQKGDQGATEIIDYNGNLHEALQRITTLTVTGPPGPPGPQGLQGTKGEQGSPGIPGMDGEQGLKGSKGDMGDPGSQWNERRKRRFWNAGSTGSFYHRPTRPTRSPWPTWPHGTSWTSWTKGSIWLRRKARIPGYRWSYGTPWPCRSQRRKR Predict reactive species Full Name: collagen, type XXV, alpha 1 Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: BC036669 Gene Symbol: COL25A1 Gene ID (NCBI): 84570 RRID: AB_2291945 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BXS0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.