Proteintech, 12757-1-AP, TRIM39 Polyclonal antibody

Size: 20ul / 150ul The TRIM39 (12757-1-AP) by Proteintech is a Polyclonal antibody targeting TRIM39 in WB, ELISA applications with reactivity to human, mouse, rat samples 12757-1-AP targets TRIM39 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse skeletal muscle tissue, mouse kidney tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3486 Product name: Recombinant human TRIM39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 189-489 aa of BC034985 Sequence: RRQQILREFEELHRRLDEEQQVLLSRLEEEEQDILQRLRENAAHLGDKRRDLAHLAAEVEGKCLQSGFEMLKDVKSTLEKCEKVKTMEVTSVSIELEKNFSNFPRQYFALRKILKQLIADVTLDPETAHPNLVLSEDRKSVKFVETRLRDLPDTPRRFTFYPCVLATEGFTSGRHYWEVEVGDKTHWAVGVCRDSVSRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRVGIFLDYEAGTLSFYNVTDRSHIYTFTDTFTEKLWPLFYPGIRAGRKNAAPLTIRPPTDWE Predict reactive species Full Name: tripartite motif-containing 39 Calculated Molecular Weight: 488aa,56 kDa; 518aa,60 kDa Observed Molecular Weight: 45 kDa, 56-60 kDa GenBank Accession Number: BC034985 Gene Symbol: TRIM39 Gene ID (NCBI): 56658 RRID: AB_10646480 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9HCM9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.