Iright
BRAND / VENDOR: Proteintech

Proteintech, 12890-2-AP, DYRK4 Polyclonal antibody

CATALOG NUMBER: 12890-2-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DYRK4 (12890-2-AP) by Proteintech is a Polyclonal antibody targeting DYRK4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 12890-2-AP targets DYRK4 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse lung tissue, human brain tissue, Jurkat cells, mouse testis tissue, U-937 cells Positive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2400 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information Dual-specificity tyrosine phosphorylation regulated kinase 4(DYRK4), belongs to a conserved family of serine/threonine protein kinases. DYRK4 is thought to function in the regulation of cell differentiation and proliferation, survival, and in development. DYRK4 has 5 isoforms with molecular weight of 59, 72 and 73 kDa. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3515 Product name: Recombinant human DYRK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 104-400 aa of BC031244 Sequence: YEVLETIGKGSFGQVAKCLDHKNNELVALKIIRNKKRFHQQALMELKILEALRKKDKDNTYNVVHMKDFFYFRNHFCITFELLGINLYELMKNNNFQGFSLSIVRRFTLSVLKCLQMLSVEKIIHCDLKPENIVLYQKGQASVKVIDFGSSCYEHQKVYTYIQSRFYRSPEVILGHPYDVAIDMWSLGCITAELYTGYPLFPGENEVEQLACIMEVLGLPPAGFIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTMVLKTYDTSFLDFLRRCLVWEPSLRMTPDQALKHAWI Predict reactive species Full Name: dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4 Calculated Molecular Weight: 520 aa, 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC031244 Gene Symbol: DYRK4 Gene ID (NCBI): 8798 RRID: AB_2094086 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NR20 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924