Iright
BRAND / VENDOR: Proteintech

Proteintech, 12929-2-AP, ASF/SF2 Polyclonal antibody

CATALOG NUMBER: 12929-2-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ASF/SF2 (12929-2-AP) by Proteintech is a Polyclonal antibody targeting ASF/SF2 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 12929-2-AP targets ASF/SF2 in WB, IHC, IF/ICC, IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, mouse brain tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:9000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information SFRS1, also named as ASF, SF2, SF2P33, SFRS1 and ASF-1, belongs to the splicing factor SR family. It plays a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing. SFRS1 interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5'- and 3'-splice site binding components, U1 snRNP and U2AF. Isoform ASF-2 and isoform ASF-3 act as splicing repressors. This antibody can recognize all the 3 isoforms(28kd,33kd and 22kd) of SFRS1. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3626 Product name: Recombinant human ASF/SF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-248 aa of BC010264 Sequence: MSGGGVIRGPAGNNDCRIYVGNLPPDIRTKDIEDVFYKYGAIRDIDLKNRRGGPPFAFVEFEDPRDAEDAVYGRDGYDYDGYRLRVEFPRSGRGTGRGGGGGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYADVYRDGTGVVEFVRKEDMTYAVRKLDNTKFRSHEGETAYIRVKVDGPRSPSYGRSRSRSRSRSRSRSRSNSRSRSYSPRRSRGSPRYSPRHSRSRSRT Predict reactive species Full Name: splicing factor, arginine/serine-rich 1 Calculated Molecular Weight: 248 aa, 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC010264 Gene Symbol: ASF/SF2 Gene ID (NCBI): 6426 RRID: AB_2187211 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q07955 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924