Proteintech, 13067-2-AP, SLC1A4 Polyclonal antibody

Size: 20ul / 150ul The SLC1A4 (13067-2-AP) by Proteintech is a Polyclonal antibody targeting SLC1A4 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 13067-2-AP targets SLC1A4 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Raji cells, mouse brain tissue, human skeletal muscle tissue, SW480 cells, mouse kidney tissue, rat brain tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: mouse kidney tissue, human kidney tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:250-1:1000 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3763 Product name: Recombinant human SLC1A4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 431-532 aa of BC026216 Sequence: IAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQKATKKGEQELAEVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKESVL Predict reactive species Full Name: solute carrier family 1 (glutamate/neutral amino acid transporter), member 4 Calculated Molecular Weight: 532 aa, 56 kDa Observed Molecular Weight: 62-70 kDa GenBank Accession Number: BC026216 Gene Symbol: SLC1A4 Gene ID (NCBI): 6509 RRID: AB_2190604 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P43007 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.