Proteintech, 13120-1-AP, TEAD3 Polyclonal antibody

Size: 20ul / 150ul The TEAD3 (13120-1-AP) by Proteintech is a Polyclonal antibody targeting TEAD3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 13120-1-AP targets TEAD3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HCT 116 cells, HepG2 cells, MCF-7 cells, L02 cells, MDA-MB-231 cells Positive IHC detected in: mouse small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information TEAD3, others named ranscriptional enhancer factor 5(TEF5), a member of family of transcription factors that plays a key role in the Hippo signaling pathway, suggesting involve in organ and tumor suppression by restricting proliferation and promoting. TEAD3 contains the TEA/ATTS DNA-binding domain. Human TEAD3 has a strong mRNA expression in placenta and choriocarcinoma cells(JEG-3), but low in Hela, HepG2 and MCF-7. This is a rabbit polyclonal anti-TEAD3 antibody raised against part of C-terminal chain of human TEAD3. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3875 Product name: Recombinant human TEAD3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-324 aa of BC027877 Sequence: MNLDQVSKDKALQSMASMSSAQIVSASVLQNKFSPPSPLPQAVFSTSSRFWSSPPLLGQQPGPSQDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEKKGGLKELYEKGPPNAFFLVKFWADLNSTIQEGPGAFYGVSSQYSSADSMTISVSTKVCSFGKQVVEKVETEYARLENGRFVYRIHRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTSRDSQETLLVIAFVFEVSTSEHGAQHHVYKLVKD Predict reactive species Full Name: TEA domain family member 3 Calculated Molecular Weight: 435 aa, 49 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC027877 Gene Symbol: TEAD3 Gene ID (NCBI): 7005 RRID: AB_2203068 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99594 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.