Proteintech, 13165-1-AP, SLC26A3 Polyclonal antibody

Size: 20ul / 150ul The SLC26A3 (13165-1-AP) by Proteintech is a Polyclonal antibody targeting SLC26A3 in IHC, ELISA applications with reactivity to human, mouse samples 13165-1-AP targets SLC26A3 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: mouse testis tissue, human colon tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:200-1:800 Background Information SLC26A3 (Chloride anion exchanger), also known as DRA. It is expected to be located in the cytoplasm and cell membranes. It is a transmembrane glycoprotein, which is mainly located in the lower digestive tract mucosa, especially in the apical membrane of columnar epithelium and some goblet cells. The expression level of SLC26A3 in intestine is different along different parts of intestine, and there are also differences on crypt-villus axis. It is mainly expressed in the apical membrane of colon epithelial cells, less in jejunum and ileum, but not in esophagus. It participates in the absorption of electrically neutral NaCl in intestine and works with Na+/H+ exchanger. Cl-/HCO3- exchange mediated by SLC26A3 is very important for maintaining intestinal acid-base balance. In duodenum, the physiological function of SLC26A3 is related to HCO3- secretion, which plays a central role in neutralizing gastric acid (PMID: 32989468). The molecular weight of SLC26A3 is 84 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3816 Product name: Recombinant human SLC26A3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 497-764 aa of BC025671 Sequence: LTIVFRTQFPKCSTLANIGRTNIYKNKKDYYDMYEPEGVKIFRCPSPIYFANIGFFRRKLIDAVGFSPLRILRKRNKALRKIRKLQKQGLLQVTPKGFICTVDTIKDSDEELDNNQIEVLDQPINTTDLPFHIDWNDDLPLNIEVPKISLHSLILDFSAVSFLDVSSVRGLKSILQEFIRIKVDVYIVGTDDDFIEKLNRYEFFDGEVKSSIFFLTIHDAVLHILMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF Predict reactive species Full Name: solute carrier family 26, member 3 Calculated Molecular Weight: 764 aa, 85 kDa Observed Molecular Weight: 84 kDa GenBank Accession Number: BC025671 Gene Symbol: SLC26A3 Gene ID (NCBI): 1811 RRID: AB_3669154 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P40879 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.