Proteintech, 13169-1-AP, QKI Polyclonal antibody

Size: 20ul / 150ul The QKI (13169-1-AP) by Proteintech is a Polyclonal antibody targeting QKI in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 13169-1-AP targets QKI in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: Neuro-2a cells, PC-12 cells Positive IP detected in: K-562 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:150-1:600 Background Information QKI (Quaking) is RNA-binding protein that plays a central role in myelinization (PMID: 16641098). It regulates pre-mRNA splicing, mRNA export and protein translation (PMID: 16641098). It acts upstream of or within several processes, including long-chain fatty acid biosynthetic process, positive regulation of macromolecule metabolic process and vasculogenesis. QKI shuttles internal m7G-modified transcripts into stress granules and modulates mRNA metabolism. It is expressed in the frontal cortex of brain (PMID: 16342280). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3822 Product name: Recombinant human QKI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-341 aa of BC019917 Sequence: MVGEMETKEKPKPTPDYLMQLMNDKKLMSSLPNFCGIFNHLERLLDEEISRVRKDMYNDTLNGSTEKRSAELPDAVGPIVQLQEKLYVPVKEYPDFNFVGRILGPRGLTAKQLEAETGCKIMVRGKGSMRDKKKEEQNRGKPNWEHLNEDLHVLITVEDAQNRAEIKLKRAVEEVKKLLVPAAEGEDSLKKMQLMELAILNGTYRDANIKSPALAFSLAATAQAAPRIITGPAPVLPPAALRTPTPAGPTIMPLIRQIQTAVMPNGTPHPTAAIVPPGPEAGLIYTPYEYPYTLAPATSILEYPIEPSGVLGAVATKVRRHDMRVHPYQRIVTADRAATGN Predict reactive species Full Name: quaking homolog, KH domain RNA binding (mouse) Calculated Molecular Weight: 341 aa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC019917 Gene Symbol: QKI Gene ID (NCBI): 9444 RRID: AB_2173138 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q96PU8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.