Proteintech, 13180-1-AP, SNX20 Polyclonal antibody

Size: 20ul / 150ul The SNX20 (13180-1-AP) by Proteintech is a Polyclonal antibody targeting SNX20 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 13180-1-AP targets SNX20 in WB, IP, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: COLO 320 cells, mouse thymus tissue Positive IP detected in: COLO 320 cells Positive IHC detected in: human placenta tissue, human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:20-1:200 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3847 Product name: Recombinant human SNX20 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-129 aa of BC027944 Sequence: MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVMGKSRPGEMTYPGSRGETGTAPEPDPRCPRQSDML Predict reactive species Full Name: sorting nexin 20 Calculated Molecular Weight: 316 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC027944 Gene Symbol: SNX20 Gene ID (NCBI): 124460 RRID: AB_10638911 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7Z614 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.