Proteintech, 13212-1-AP, CARTPT Polyclonal antibody

Size: 20ul / 150ul The CARTPT (13212-1-AP) by Proteintech is a Polyclonal antibody targeting CARTPT in WB, ELISA applications with reactivity to human, mouse, rat samples 13212-1-AP targets CARTPT in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SH-SY5Y cells, human adrenal gland tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4004 Product name: Recombinant human CARTPT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-116 aa of BC029882 Sequence: AQEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL Predict reactive species Full Name: CART prepropeptide Calculated Molecular Weight: 116 aa, 13 kDa Observed Molecular Weight: 4-14 kDa GenBank Accession Number: BC029882 Gene Symbol: CARTPT Gene ID (NCBI): 9607 RRID: AB_10666161 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q16568 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.