Iright
BRAND / VENDOR: Proteintech

Proteintech, 13242-1-AP, NBPF1 Polyclonal antibody

CATALOG NUMBER: 13242-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NBPF1 (13242-1-AP) by Proteintech is a Polyclonal antibody targeting NBPF1 in IHC, IF/ICC, IP, ELISA applications with reactivity to human samples 13242-1-AP targets NBPF1 in IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: HeLa cells Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: BxPC-3 cells, Jurkat cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information NBPF1 (Neuroblastoma Breakpoint Family, member 1) was originally identified in a neuroblastoma patient on the basis of its disruption by a chromosomal translocation t(1;17) Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4096 Product name: Recombinant human NBPF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 303-603 aa of BC034418 Sequence: PSGYLELTDSCQPYRSAFYILEQQRVGWALDMDEIEKYQEVEEDQDPSCPRLSRELLDEKEPEVLQDSLDRCYSTPSGYLELPDLGQPYRSAVYSLEEQYLGLALDVDRIKKDQEEEEDQGPPCPRLSRELLEAVEPEVLQDSLDRCYSTPSSCLEQPDSCLPYGSSFYALEEKHVGFSLDVGEIEKKGKGKKRRGRRSTKKRRRRGRKEGEEDQNPPCPRLSGVLMEVEEPEVLQDSLDRCYSTPSMFFELPDSFQHYRSVFYSFEEQHISFALDVDNRFLTLMGRSLHLVFQMGVIFPQ Predict reactive species Full Name: neuroblastoma breakpoint family, member 1 Calculated Molecular Weight: 1213 aa, 139 kDa Observed Molecular Weight: 139 kDa GenBank Accession Number: BC034418 Gene Symbol: NBPF1 Gene ID (NCBI): 55672 RRID: AB_3669156 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q3BBV0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924