Proteintech, 13244-1-AP, ASPA Polyclonal antibody

Size: 20ul / 150ul The ASPA (13244-1-AP) by Proteintech is a Polyclonal antibody targeting ASPA in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13244-1-AP targets ASPA in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ASPA(Aspartoacylase) also called aminoacylase-2, is an enzyme that hydrolyzes N-acetyl-L-aspartic acid (NAA) to aspartate and acetate.Human ASPA encodes a deduced 313-amino acid protein with a molecular mass of 36 KDa. It shares 92% sequence identity with the bovine protein and contains 1 potential N-glycosylation site and 5 phosphorylation sites.Defects in ASPA are the cause of Canavan disease (CAND).This protein can exsit as a homodimer(18293939). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4029 Product name: Recombinant human ASPA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-313 aa of BC029128 Sequence: MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH Predict reactive species Full Name: aspartoacylase (Canavan disease) Calculated Molecular Weight: 313 aa, 36 kDa Observed Molecular Weight: 36 kDa GenBank Accession Number: BC029128 Gene Symbol: ASPA Gene ID (NCBI): 443 RRID: AB_2274358 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P45381 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.