Proteintech, 13255-1-AP, SPPL2A Polyclonal antibody

Size: 20ul / 150ul The SPPL2A (13255-1-AP) by Proteintech is a Polyclonal antibody targeting SPPL2A in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 13255-1-AP targets SPPL2A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human colon tissue, Jurkat cells, mouse colon tissue Positive IHC detected in: human testis tissue, human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information SPPL2A(Signal peptide peptidase-like 2A) is also named as IMP3(Intramembrane protease 3), PSL2(Presenilin-like protein 2) and belongs to the peptidase A22B family. It is an aspartyl intramembrane protease, has been implicated in the proteolysis of TNF-alpha, Fas Ligand and Bri2 and endogenous signal-peptide-peptidase-like2A (SPPL2a) is localised in lysosomes/late endosomes(PMID:21896273). This protein has a signal peptide with 25 amino acid and seven glycosylation sites. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag3935 Product name: Recombinant human SPPL2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 361-520 aa of BC025740 Sequence: ITKNGESIMVELAAGPFGNNEKLPVVIRVPKLIYFSVMSVCLMPVSILGFGDIIVPGLLIAYCRRFDVQTGSSYIYYVSSTVAYAIGMILTFVVLVLMKKGQPALLYLVPCTLITASVVAWRRKEMKKFWKGNSYQMMDHLDCATNEENPVISGEQIVQQ Predict reactive species Full Name: signal peptide peptidase-like 2A Calculated Molecular Weight: 520 aa, 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: BC025740 Gene Symbol: SPPL2A Gene ID (NCBI): 84888 RRID: AB_2195000 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8TCT8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.