Iright
BRAND / VENDOR: Proteintech

Proteintech, 13304-1-AP, P-selectin / CD62P Polyclonal antibody

CATALOG NUMBER: 13304-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The P-selectin / CD62P (13304-1-AP) by Proteintech is a Polyclonal antibody targeting P-selectin / CD62P in WB, IHC, ELISA applications with reactivity to human samples 13304-1-AP targets P-selectin / CD62P in WB, IHC, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Human peripheral blood platelets Positive IHC detected in: human spleen tissue, human tonsillitis tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information P-selectin, also known as GMP140 or CD62P, is a transmembrane glycoprotein that mediates the interaction of activated endothelial cells or platelets with leukocytes. It is an adhesion molecule involved in the pathogenesis of inflammation, thrombosis, and oncogenesis. P-selectin is stored in the alpha-granules of platelets and Weibel-Palade bodies of endothelial cells. Upon cell activation by agonists, P-selectin is transported rapidly to the cell surface. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4124 Product name: Recombinant human SELP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 441-789 aa of BC028067 Sequence: VCQALQCQDLPVPNEARVNCSHPFGAFRYQSVCSFTCNEGLLLVGASVLQCLATGNWNSVPPECQAIPCTPLLSPQNGTMTCVQPLGSSSYKSTCQFICDEGYSLSGPERLDCTRSGRWTDSPPMCEAIKCPELFAPEQGSLDCSDTRGEFNVGSTCHFSCNNGFKLEGPNNVECTTSGRWSATPPTCKGIASLPTPGVQCPALTTPGQGTMYCRHHPGTFGFNTTCYFGCNAGFTLIGDSTLSCRPSGQWTAVTPACRAVKCSELHVNKPIAMNCSNLWGNFSYGSICSFHCLEGQLLNGSAQTACQENGHWSTTVPTCQDDGKCPLNPHSHLGTYGVFTNAAFDPSP Predict reactive species Full Name: selectin P (granule membrane protein 140kDa, antigen CD62) Calculated Molecular Weight: 830 aa, 91 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC028067 Gene Symbol: CD62P Gene ID (NCBI): 6403 RRID: AB_2877937 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P16109 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924