Proteintech, 13364-1-AP, ERGIC-53 Polyclonal antibody

Size: 20ul / 150ul The ERGIC-53 (13364-1-AP) by Proteintech is a Polyclonal antibody targeting ERGIC-53 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 13364-1-AP targets ERGIC-53 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, mouse brain tissue, human brain tissue, HeLa cells, HepG2 cells, Jurkat cells, MCF-7 cells, mouse heart tissue, mouse spleen tissue, rat heart tissue, rat spleen tissue Positive IP detected in: HepG2 cells Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ERGIC-53 (also known as LMAN1 or MR60) is a membrane mannose-specific lectin that selectively transports its cargo proteins from ER to ER-Golgi intermediate compartment (ERGIC) and Golgi, functioning as a cargo transport receptor for glycoproteins (PMID: 24664723; 10559958). Mutations in ERGIC-53 cause combined deficiency of coagulation factors V and VIII (PMID: 9546392). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4183 Product name: Recombinant human LMAN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 35-401 aa of BC032330 Sequence: GDPAVALPHRRFEYKYSFKGPHLVQSDGTVPFWAHAGNAIPSSDQIRVAPSLKSQRGSVWTKTKAAFENWEVEVTFRVTGRGRIGADGLAIWYAENQGLEGPVFGSADLWNGVGIFFDSFDNDGKKNNPAIVIIGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILR Predict reactive species Full Name: lectin, mannose-binding, 1 Calculated Molecular Weight: 510 aa, 54 kDa Observed Molecular Weight: 54 kDa GenBank Accession Number: BC032330 Gene Symbol: ERGIC-53 Gene ID (NCBI): 3998 RRID: AB_2135994 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49257 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.