Proteintech, 13454-1-AP, Siglec-6 Polyclonal antibody

Size: 20ul / 150ul The Siglec-6 (13454-1-AP) by Proteintech is a Polyclonal antibody targeting Siglec-6 in IHC, ELISA applications with reactivity to human samples 13454-1-AP targets Siglec-6 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Siglec-6, originally identified on trophoblast cells of the placenta, is highly and consistently expressed on MCs from both mucosal and non-mucosal sites. Siglec-6 consists of 3 extracellular immunoglobulin (Ig) domains and 2 intracellular immunoreceptor tyrosine-based inhibition motifs (ITIMs), closely resembling the molecular structure of Siglec-3 (CD33) (PMID: 34289026). Siglec-6 was recruited to placental expression during human evolution, presumably to interact with sialylated ligands for specific negative signaling functions and/or to regulate leptin availability (PMID: 17580316). Siglec-6 is an immunoreceptor tyrosine-based inhibitory motif (ITIM)-bearing receptor selectively expressed by mast cells, making it a promising target for therapeutic intervention (PMID: 35406705). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4281 Product name: Recombinant human SIGLEC6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-200 aa of BC035359 Sequence: QERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHST Predict reactive species Full Name: sialic acid binding Ig-like lectin 6 Calculated Molecular Weight: 426 aa, 47 kDa GenBank Accession Number: BC035359 Gene Symbol: SIGLEC6 Gene ID (NCBI): 946 RRID: AB_2189287 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O43699 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.