Proteintech, 13475-1-AP, SLC22A18AS Polyclonal antibody

Size: 20ul / 150ul The SLC22A18AS (13475-1-AP) by Proteintech is a Polyclonal antibody targeting SLC22A18AS in IP, ELISA applications with reactivity to human samples 13475-1-AP targets SLC22A18AS in IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive IP detected in: HepG2 cells Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information The SLC22A18/SLC22A18AS genes are a sense-antisense pair located at human chromosome segment 11p15.5. These genes are paternally imprinted: paternal alleles are silenced and maternal alleles are expressed. SLC22A18AS (antisense) is associated to SLC22A18 (sense). These two genes share, in divergent orientations, 31 bp in their 5′ regions (between the first exon of SLC22A18AS and the second exon of SLC22A18). This antibody recognizes SLC22A18AS only. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4274 Product name: Recombinant human SLC22A18AS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-150 aa of BC030237 Sequence: MRCAEGAWWFSPDGPAGSAASIWPAEGAEGLPGQLGRDRLEVVYSVPDNVPGQNGSRRPLVCKITGKCLSVCSEENAKAGGCSAFPLLLSQLGARMTGREHAHKGPELTTPDSGLPRPPNPALAGFRALAQHSPPLGTSTPSAVLLSAAT Predict reactive species Full Name: solute carrier family 22 (organic cation transporter), member 18 antisense Calculated Molecular Weight: 253 aa, 27 kDa Observed Molecular Weight: 30 kDa, 65 kDa GenBank Accession Number: BC030237 Gene Symbol: SLC22A18AS Gene ID (NCBI): 5003 RRID: AB_2877953 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N1D0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.