Proteintech, 13533-1-AP, HMGCR Polyclonal antibody

Size: 20ul / 150ul The HMGCR (13533-1-AP) by Proteintech is a Polyclonal antibody targeting HMGCR in IHC, ELISA applications with reactivity to human, mouse, rat samples 13533-1-AP targets HMGCR in IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: human liver cancer tissue, human small intestine tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information HMGCR(3-hydroxy-3-methylglutaryl-coenzyme A reductase) is also named as HMG-CoA reductase and belongs to the HMG-CoA reductase family. This protein exists as a 97-kDa glycoprotein in the endoplasmic reticulum (ER) and is the rate-determining enzyme of the biosynthesis pathway(PMID:15830340).The ectopic expression of either full-length HMGCR or its novel splice variant promotes dysregulation of the MVA pathway. And the ectopic expression of cHMGCR-FL(60 kDa) and cHMGCR-D13(55 kDa) can be detected in HepG2 cells(PMID:20696928).This protein is also can exsit as a oligomer(PMID:20696928). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4444 Product name: Recombinant human HMGCR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 536-835 aa of BC033692 Sequence: TRGPVVRLPRACDSAEVKAWLETSEGFAVIKEAFDSTSRFARLQKLHTSIAGRNLYIRFQSRSGDAMGMNMISKGTEKALSKLHEYFPEMQILAVSGNYCTDKKPAAINWIEGRGKSVVCEAVIPAKVVREVLKTTTEAMIEVNINKNLVGSAMAGSIGGYNAHAANIVTAIYIACGQDAAQNVGSSNCITLMEASGPTNEDLYISCTMPSIEIGTVGGGTNLLPQQACLQMLGVQGACKDNPGENARQLARIVCGTVMAGELSLMAALAAGHLVKSHMIHNRSKINLQDLQGACTKKTA Predict reactive species Full Name: 3-hydroxy-3-methylglutaryl-Coenzyme A reductase Calculated Molecular Weight: 888 aa, 95 kDa GenBank Accession Number: BC033692 Gene Symbol: HMGCR Gene ID (NCBI): 3156 RRID: AB_2877957 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04035 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.