Proteintech, 13643-1-AP, AHSP Polyclonal antibody

Size: 20ul / 150ul The AHSP (13643-1-AP) by Proteintech is a Polyclonal antibody targeting AHSP in WB, IHC, ELISA applications with reactivity to human, mouse, pig samples 13643-1-AP targets AHSP in WB, IHC, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: pig bone marrow tissue Positive IHC detected in: human placenta tissue, mouse lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information AHSP acts as a chaperone to prevent the harmful aggregation of alpha-hemoglobin during normal erythroid cell development, and specifically protects free alpha-hemoglobin from precipitation. It is predicted to modulate pathological states of alpha-hemoglobin excess such as beta-thalassemia (PMID: 12066189). Specification Tested Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4588 Product name: Recombinant human ERAF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-102 aa of BC035842 Sequence: MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKSHELPSHPPPSS Predict reactive species Full Name: erythroid associated factor Calculated Molecular Weight: 102 aa, 12 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: BC035842 Gene Symbol: AHSP Gene ID (NCBI): 51327 RRID: AB_3669167 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NZD4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.