Proteintech, 13711-1-AP, KIF2B Polyclonal antibody

Size: 20ul / 150ul The KIF2B (13711-1-AP) by Proteintech is a Polyclonal antibody targeting KIF2B in WB, IP, ELISA applications with reactivity to human, mouse samples 13711-1-AP targets KIF2B in WB, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse testis tissue Positive IP detected in: mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information KIF2B belongs to the TRAFAC class myosin-kinesin ATPase superfamily, Kinesin family and MCAK/KIF2 subfamily. KIF2B is evidently required for spindle assembly, chromosome movement and cytokinesis (PMID: 17538014). The molecular weight of KIF2B is 76 kDa. It plays an important role in chromosome congression (PMID: 23891108). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4648 Product name: Recombinant human KIF2B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-350 aa of BC033802 Sequence: MASQFCLPESPCLSPLKPLKPHFGDIQEGIYVAIQRSDKRIHLAVVTEINRENYWVTVEWVEKAVKKGKKIDLETILLLNPALDSAEHPMPPPPLSPLALAPSSAIRDQRTATKWVAMIPQKNQTASGDSLDVRVPSKPCLMKQKKSPCLWEIQKLQEQREKRRRLQQEIRARRALDVNTRNPNYEIMHMIEEYRRHLDSSKISVLEPPQEHRICVCVRKRPLNQRETTLKDLDIITVPSDNVVMVHESKQKVDLTRYLQNQTFCFDHAFDDKASNELVYQFTAQPLVESIFRKGMATCFAYGQTGSGKTYTMGGDFSGTAQDCSKGIYALVAQDVFLLLRNSTYEKLDL Predict reactive species Full Name: kinesin family member 2B Calculated Molecular Weight: 673 aa, 76 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC033802 Gene Symbol: KIF2B Gene ID (NCBI): 84643 RRID: AB_2131885 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N4N8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.