Proteintech, 13721-1-AP, Phospholemman/FXYD1 Polyclonal antibody

Size: 20ul / 150ul The Phospholemman/FXYD1 (13721-1-AP) by Proteintech is a Polyclonal antibody targeting Phospholemman/FXYD1 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 13721-1-AP targets Phospholemman/FXYD1 in WB, IP, IF, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human skeletal muscle tissue, rat skeletal muscle tissue, mouse skeletal muscle tissue, rat heart tissue, mouse heart tissue, mouse kidney tissue, human brain tissue Positive IP detected in: mouse heart tissue Positive IHC detected in: mouse heart tissue, human skeletal muscle tissue, human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1500 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information FXYD1, also named as PLM and Phospholemman, belongs to the FXYD family. FXYD1 induces a hyperpolarization-activated chloride current when expressed in Xenopus oocytes. It may have a functional role in muscle contraction. FXYD1 is a partner protein and regulator of the Na+,K+-ATPase (Na+,K+-pump). It may play a role in the acute regulation of the Na+,K+-ATPase response to exercise. (PMID: 20595385, 21653224) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4669 Product name: Recombinant human FXYD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-92 aa of BC032800 Sequence: MASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEEEGTFRSSIRRLSTRRR Predict reactive species Full Name: FXYD domain containing ion transport regulator 1 Calculated Molecular Weight: 92 aa, 10 kDa Observed Molecular Weight: 10-15 kDa GenBank Accession Number: BC032800 Gene Symbol: FXYD1 Gene ID (NCBI): 5348 RRID: AB_2108296 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00168 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.