Proteintech, 13914-1-AP, SNN Polyclonal antibody

Size: 20ul / 150ul The SNN (13914-1-AP) by Proteintech is a Polyclonal antibody targeting SNN in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 13914-1-AP targets SNN in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive IHC detected in: mouse brain tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Stannin (Snn) is discovered using subtractive hybridization methodology designed to find gene products related to selective organotin toxicity and apoptosis. It is present in TMT-sensitive cells and may play a role in the selective toxicity of organotin compounds. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag4909 Product name: Recombinant human SNN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC036443 Sequence: MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEVHG Predict reactive species Full Name: stannin Calculated Molecular Weight: 9 kDa GenBank Accession Number: BC036443 Gene Symbol: SNN Gene ID (NCBI): 8303 RRID: AB_2918033 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75324 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.