Product Description
Size: 20ul / 150ul
The SNN (13914-1-AP) by Proteintech is a Polyclonal antibody targeting SNN in IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples
13914-1-AP targets SNN in IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive IHC detected in: mouse brain tissue, mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF/ICC detected in: U2OS cells
Recommended dilution
Immunohistochemistry (IHC): IHC : 1:50-1:500
Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
Background Information
Stannin (Snn) is discovered using subtractive hybridization methodology designed to find gene products related to selective organotin toxicity and apoptosis. It is present in TMT-sensitive cells and may play a role in the selective toxicity of organotin compounds.
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag4909 Product name: Recombinant human SNN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-88 aa of BC036443 Sequence: MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEVHG Predict reactive species
Full Name: stannin
Calculated Molecular Weight: 9 kDa
GenBank Accession Number: BC036443
Gene Symbol: SNN
Gene ID (NCBI): 8303
RRID: AB_2918033
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: O75324
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924