Proteintech, 13951-1-AP, ALDH1A2 Polyclonal antibody

Size: 20ul / 150ul The ALDH1A2 (13951-1-AP) by Proteintech is a Polyclonal antibody targeting ALDH1A2 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 13951-1-AP targets ALDH1A2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: K-562 cells, mouse spleen tissue, mouse testis tissue, rat spleen tissue, rat testis tissue Positive IP detected in: mouse testis tissue Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ALDH1A2(aldehyde dehydrogenase family 1 member A2) is also named as RALDH2(retinal dehydrogenase 2) and belongs to the aldehyde dehydrogenase family. It is a cytosolic homotetramer(56.7 kDa subunits) exhibiting complex expression patterns throughout embryonic development. ALDH1A2 plays a role in retinoid metabolism during embryonic development where it is considered to be the major retinoic acid-synthesizing enzyme during early embryogenesis(PMID:20735668). Its expression is reduced in primary prostate tumors compared with normal prostate tissue suggested that it is normally expressed in the epithelial compartment of prostate tissue(PMID:16166285).It has 2 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5062 Product name: Recombinant human ALDH1A2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 181-481 aa of BC030589 Sequence: GQIIPWNFPLLMFAWKIAPALCCGNTVVIKPAEQTPLSALYMGALIKEVGKLIQEAAGRSNLKRVTLELGGKSPNIIFADADLDYAVEQAHQGVFFNQGQCCTAGSRIFVEESIYEEFVRRSVERAKRRVVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTVWINCYNALNAQSPFGGFKMSGNGREMGEFGLREYSEVKTVTVKIPQKNS Predict reactive species Full Name: aldehyde dehydrogenase 1 family, member A2 Calculated Molecular Weight: 518 aa, 57 kDa Observed Molecular Weight: 53-57 kDa GenBank Accession Number: BC030589 Gene Symbol: ALDH1A2 Gene ID (NCBI): 8854 RRID: AB_2224033 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O94788 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.