Proteintech, 13952-1-AP, ADAM2 Polyclonal antibody

Size: 20ul / 150ul The ADAM2 (13952-1-AP) by Proteintech is a Polyclonal antibody targeting ADAM2 in WB, ELISA applications with reactivity to human, mouse samples 13952-1-AP targets ADAM2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse testis tissue, human testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information The members of the ADAM (a disintegrin and metalloprotease) family are membrane-anchored multi-domain proteins that play prominent roles in male reproduction(PMID: 27341348). Fertilin, a heterodimeric protein complex composed of a(ADAM1) and b(ADAM2) subunits present on the sperm surface, has been believed to mediate adhesion and fusion between the sperm and egg plasma membranes. ADAM2-deficient mouse sperm is also defective in adhesion to and fusion with the egg membrane (PMID:16407235). It has 2 isoforms produced by alternative splicing and 5 glycosylation sites. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5063 Product name: Recombinant human ADAM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-353 aa of BC034957 Sequence: MWRVLFLLSGLGGLRMDSNFDSLPVQITVPEKIRSIIKEGIESQASYKIVIEGKPYTVNLMQKNFLPHNFRVYSYSGTGIMKPLDQDFQNFCHYQGYIEGYPKSVVMVSTCTGLRGVLQFENVSYGIEPLESSVGFEHVIYQVKHKKADVSLYNEKDIESRDLSFKLQSVEYNHMGSDTTVVAQKVFQLIGLTNAIFVSFNITIILSSLELWIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVILAQLLSLSMGITYDDINKCQCSGAVCIMNPEAIHFSGVKIFSNCSFEDFAHFISKQKSQCLH Predict reactive species Full Name: ADAM metallopeptidase domain 2 Calculated Molecular Weight: 82 kDa Observed Molecular Weight: 50-55 kDa, 65-75 kDa GenBank Accession Number: BC034957 Gene Symbol: ADAM2 Gene ID (NCBI): 2515 RRID: AB_2877996 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99965 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.