Proteintech, 14060-1-AP, PARK2/Parkin Polyclonal antibody

Size: 20ul / 150ul The PARK2/Parkin (14060-1-AP) by Proteintech is a Polyclonal antibody targeting PARK2/Parkin in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 14060-1-AP targets PARK2/Parkin in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse brain tissue, C6 cells, HEK-293 cells, mouse liver tissue, PC-12 cells, rat brain tissue, pig brain tissue Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse heart tissue, mouse brain tissue Positive IF/ICC detected in: RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Parkin, a RING-type E3 ubiquitin-protein ligase, is involved in the ubiquitination pathway and contributes to protection from neurotoxicity induced by unfolded protein stresses. Its ubiquitin-protein ligase activity promotes the degradation of a variety of proteins including itself. Mutations in Parkin are implicated in the pathogenesis of autosomal recessive familial Parkinson's disease. It has 8 isoforms produced by alternative splicing with molecular weights of 24, 31, 36 and 42-52 kDa. Sometimes an additional band of 70 kDa or 110 kDa may be detected, which is caused by ubiquitination modification or formation of Parkin complex (PMID: 10976934, PMID: 18190519). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat, pig, rabbit, monkey, chicken, bovine, cattle, ducks Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5092 Product name: Recombinant human Parkin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 81-387 aa of BC022014 Sequence: NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK Predict reactive species Full Name: Parkinson disease (autosomal recessive, juvenile) 2, parkin Calculated Molecular Weight: 52 kDa Observed Molecular Weight: 42-52 kDa GenBank Accession Number: BC022014 Gene Symbol: Parkin Gene ID (NCBI): 5071 RRID: AB_2878005 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60260 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.