Proteintech, 14131-1-AP, CHST15 Polyclonal antibody

Size: 20ul / 150ul The CHST15 (14131-1-AP) by Proteintech is a Polyclonal antibody targeting CHST15 in WB, ELISA applications with reactivity to human, mouse samples 14131-1-AP targets CHST15 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Carbohydrate sulfotransferase 15, also known as CHST15, BRAG, GALNAC4S6ST and KIAA0598, is a single-pass type II membrane protein which belongs to the sulfotransferase 1 family. CHST15 is a sulfotransferase that transfers sulfate from 3'-phosphoadenosine 5'-phosphosulfate (PAPS) to the C-6 hydroxyl group of the GalNAc 4-sulfate residue of chondroitin sulfate A and forms chondroitin sulfate E containing GlcA-GalNAc(4,6-SO4) repeating units. It also transfers sulfate to a unique non-reducing terminal sequence, GalNAc(4SO4)-GlcA(2SO4)-GalNAc(6SO4), to yield a highly sulfated structure similar to the structure found in thrombomodulin chondroitin sulfate. CHST15 may also act as a B-cell receptor involved in BCR ligation-mediated early activation that mediate regulatory signals key to B-cell development and / or regulation of B-cell-specific RAG expression. CHST15 is expressed in B-cell-enriched tissues but not in fetal or adult thymus. It is expressed in fetal and adult spleen, lymph node, tonsil, bone marrow and peripheral leukocytes. It can be detected as 49 kDa and 69 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5258 Product name: Recombinant human CHST15 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 262-561 aa of BC027908 Sequence: PKCGTTDLYDRLRLHPEVKFSAIKEPHWWTRKRFGIVRLRDGLRDRYPVEDYLDLFDLAAHQIHQGLQASSAKEQSKMNTIIIGEASASTMWDNNAWTFFYDNSTDGEPPFLTQDFIHAFQPNARLIVMLRDPVERLYSDYLYFASSNKSADDFHEKVTEALQLFENCMLDYSLRACVYNNTLNNAMPVRLQVGLYAVYLLDWLSVFDKQQFLILRLEDHASNVKYTMHKVFQFLNLGPLSEKQEALMTKSPASNARRPEDRNLGPMWPITQKILRDFYRPFNARLAQVLADEAFAWKTT Predict reactive species Full Name: carbohydrate (N-acetylgalactosamine 4-sulfate 6-O) sulfotransferase 15 Calculated Molecular Weight: 65 kDa Observed Molecular Weight: 55-58 kDa, 65-69 kDa GenBank Accession Number: BC027908 Gene Symbol: CHST15 Gene ID (NCBI): 51363 RRID: AB_2878020 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q7LFX5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.