Iright
BRAND / VENDOR: Proteintech

Proteintech, 14172-1-AP, SCTR Polyclonal antibody

CATALOG NUMBER: 14172-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SCTR (14172-1-AP) by Proteintech is a Polyclonal antibody targeting SCTR in WB, ELISA applications with reactivity to human, mouse, rat samples 14172-1-AP targets SCTR in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse pancreas tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information SCTR is a member of the family B G protein-coupled receptors. SCTR is a receptor for SCT, a gastrointestinal peptide hormone secreted by the S cells of the duodenum. SCT regulates water homeostasis throughout the body, and influences the environment of the duodenum by regulating SCT in the stomach and pancreas. Studies suggest that SCT can act as a neuropeptide within the central nervous system (CNS), thus SCTR may regulate the function of the CNS. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5371 Product name: Recombinant human SCTR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 36-142 aa of BC035757 Sequence: QVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKL Predict reactive species Full Name: SCTR Calculated Molecular Weight: 440 aa, 50 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: BC035757 Gene Symbol: SCTR Gene ID (NCBI): 6344 RRID: AB_10642561 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P47872 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924