Proteintech, 14200-1-AP, B3GNT2 Polyclonal antibody

Size: 20ul / 150ul The B3GNT2 (14200-1-AP) by Proteintech is a Polyclonal antibody targeting B3GNT2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 14200-1-AP targets B3GNT2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: Jurkat cells, MCF-7 cells, SMMC-7721 cells, mouse brain tissue Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:300-1:1200 Background Information β-1,3-N-acetylglucosaminyltransferase (B3GNT2) is the most abundant and ubiquitously expressed B3GNT isoform and displays the greatest in vitro activity for N-glycan and O-glycan poly-LacNAc extensionis. B3GNT2 encodes a poly-N-acetyllactosamine synthase that targets >10 ligands and receptors to disrupt interactions between tumor and T cells and reduce T cell activation (PMID: 35338135, 32663509). B3GNT2 also has five predicted N-glycosylation sites at asparagine residues 79, 89, 127, 173, and 219 (PMID: 33229435). Western blots indicated the glycosylated form of B3GNT2 is detected at ~ 67 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5404 Product name: Recombinant human B3GNT2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 47-397 aa of BC030579 Sequence: KFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKC Predict reactive species Full Name: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 2 Calculated Molecular Weight: 9 kDa Observed Molecular Weight: 69 kDa GenBank Accession Number: BC030579 Gene Symbol: B3GNT2 Gene ID (NCBI): 10678 RRID: AB_3085431 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NY97 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.