Proteintech, 14232-1-AP, Kallikrein 8 Polyclonal antibody

Size: 20ul / 150ul The Kallikrein 8 (14232-1-AP) by Proteintech is a Polyclonal antibody targeting Kallikrein 8 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14232-1-AP targets Kallikrein 8 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information KLK8(Kallikrein-8) is also named as NRPN, PRSS19, TADG14.It is a new member of the human kallikrein family, which is predicted to be secreted and expected to be present in biological fluids (PMID:12507964).The protein is detectable in ovarian cancer tissue extracts, serum, and ascites fluid, indicating that it may serve as a new ovarian cancer marker (PMID:12782581). KLK8 has one predicted glycosylation site (PMID:20940292) and it has some isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5472 Product name: Recombinant human KLK8 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-260 aa of BC040887 Sequence: MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDVMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG Predict reactive species Full Name: kallikrein-related peptidase 8 Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 30 kDa GenBank Accession Number: BC040887 Gene Symbol: KLK8 Gene ID (NCBI): 11202 RRID: AB_2134643 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O60259 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.