Iright
BRAND / VENDOR: Proteintech

Proteintech, 14246-1-AP, NR2E3 Polyclonal antibody

CATALOG NUMBER: 14246-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NR2E3 (14246-1-AP) by Proteintech is a Polyclonal antibody targeting NR2E3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples 14246-1-AP targets NR2E3 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: mouse retina tissue, Y79 cells, HepG2 cells, rat retina tissue Positive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: photoreceptor progenitor cells Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:100 Background Information NR2E3, also known as PNR, encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. NR2E3 influences the development of photoreceptors and their differentiation into rod and cone types, and acts as a ranscriptional factor that is an activator of rod development and repressor of cone development [PMID:20725840]. It binds the promoter region of a number of rod- and cone-specific genes, including rhodopsin, M- and S-opsin and rod-specific phosphodiesterase beta subunit. [PMID:15689355] Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, zebrafish Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5503 Product name: Recombinant human NR2E3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-322 aa of BC041421 Sequence: MCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN Predict reactive species Full Name: nuclear receptor subfamily 2, group E, member 3 Calculated Molecular Weight: 45 kDa Observed Molecular Weight: 43-45 kDa GenBank Accession Number: BC041421 Gene Symbol: NR2E3 Gene ID (NCBI): 10002 RRID: AB_2155476 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y5X4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924