Proteintech, 14324-1-AP, BCO2 Polyclonal antibody

Size: 20ul / 150ul The BCO2 (14324-1-AP) by Proteintech is a Polyclonal antibody targeting BCO2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14324-1-AP targets BCO2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse liver tissue, L02 cells, rat liver tissue Positive IHC detected in: human prostate hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Beta,beta-carotene 9',10'-oxygenase (BCO2) catalyzes the asymmetric oxidative cleavage of beta-carotene in carotene metabolism.The apocarotenals formed by this enzyme may be the precursors for the biosynthesis of retinoic acid or exert unknown physiological effects. BCDO2 plays an important role in protecting against carotenoid-induced mitochondrial dysfunction and has a broader substrate specificity than previously recognized (PMID:22147584). This antibody detects the N-terminal of BCO2. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5590 Product name: Recombinant human BCO2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 159-506 aa of BC041656 Sequence: ERFMSRFELPGKAAGFSYKVIRVPPEKVDLGETIHGVQVICSIASTEKGKPSYYHSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGISWEPQCNTRFHVVEKRTGQLLPGRYYSKPFVTFHQINAFEDQGCVIIDLCCQDNGRTLEVYQLQNLRKAGEGLDQVHNSAAKSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSHENLHQEDLEKEGGIEFPQIYYDRFSGKKYHFFYGCGFRHLVGDSLIKVDVVNKTLKVWREDGFYPSEPVFVPAPGTNEEDGGVILSVVITPNQNESNFLLVLDAKNFEELGRAEVPVQMPYGFHGTFIPI Predict reactive species Full Name: beta-carotene oxygenase 2 Calculated Molecular Weight: 66 kDa Observed Molecular Weight: 60-65 kDa GenBank Accession Number: BC041656 Gene Symbol: BCO2 Gene ID (NCBI): 83875 RRID: AB_2227901 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BYV7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.