Proteintech, 14376-1-AP, BMPR2 Polyclonal antibody

Size: 20ul / 150ul The BMPR2 (14376-1-AP) by Proteintech is a Polyclonal antibody targeting BMPR2 in WB, IP, ELISA applications with reactivity to human, mouse, rat samples 14376-1-AP targets BMPR2 in WB, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue Positive IP detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information BMPs (bone morphogenetic protein) are involved in endochondral bone formation and embryogenesis. BMPR2 encodes a member of the (BMP) receptor family of transmembrane serine/threonine kinases. It is a widely expressed receptor, with high mRNA expression during development in many tissues. Dimer of BMPR2 receptors (70-80 kD) forms a complex with a dimer of type I BMPR1(50-55 kD) in signal transduction. This antibody recognizes endogenous levels of total BMPR2 protein, including 115 kD precursor, 75 kD mature form and 150 kD dimer. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5752 Product name: Recombinant human BMPR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 172-504 aa of BC052985 Sequence: YRMLTGDRKQGLHSMNMMEAAASEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNFINEKNIYRVPLMEHDNIARFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVSSCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMRLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRCTDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETIEDCWDQDAEARLTAQCAEERMAEL Predict reactive species Full Name: bone morphogenetic protein receptor, type II (serine/threonine kinase) Calculated Molecular Weight: 115 kDa Observed Molecular Weight: 120 kDa GenBank Accession Number: BC052985 Gene Symbol: BMPR2 Gene ID (NCBI): 659 RRID: AB_10639044 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13873 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.