Iright
BRAND / VENDOR: Proteintech

Proteintech, 14479-1-AP, Calbindin-D28k Polyclonal antibody

CATALOG NUMBER: 14479-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Calbindin-D28k (14479-1-AP) by Proteintech is a Polyclonal antibody targeting Calbindin-D28k in WB, IHC, IF-P, IF-Fro, IP, ELISA applications with reactivity to human, mouse, rat samples 14479-1-AP targets Calbindin-D28k in WB, IHC, IF-P, IF-Fro, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: fetal human brain tissue, mouse brain tissue, rat brain tissue, mouse cerebellum tissue Positive IP detected in: mouse brain tissue Positive IHC detected in: human cerebellum tissue, hippocampus, human brain tissue, human kidney tissue, mouse cerebellum tissue, mouse kidney tissue, rat cerebellum tissue, rat kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue, human kidney tissue Positive IF-Fro detected in: mouse cerebellum tissue, rat cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)-FRO: IF-FRO : 1:50-1:500 Background Information Calbindin-D28k is a member of the calcium-binding protein superfamily that includes calmodulin and troponin C. It is a cytosolic calcium binding protein highly expressed in the distal tubule, intestines, central nervous system, primary murine osteoblast cells and in several other organs. It plays an important role in the intracellular calcium homeostasis, its strong buffering capacity prevents cytotoxic effect of high concentration of free calcium in kidney, brain, pancreas, and intestine. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, monkey, chicken Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5861 Product name: Recombinant human Calbindin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 110-261 aa of BC006478 Sequence: YDTDHSGFIETEELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLKFQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQDLDINNITTYKKNIMALSDGGKLYRTDLALILCAGDN Predict reactive species Full Name: calbindin 1, 28kDa Calculated Molecular Weight: 30 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC006478 Gene Symbol: Calbindin Gene ID (NCBI): 793 RRID: AB_2228318 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05937 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924