Iright
BRAND / VENDOR: Proteintech

Proteintech, 14535-1-AP, GSTK1 Polyclonal antibody

CATALOG NUMBER: 14535-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GSTK1 (14535-1-AP) by Proteintech is a Polyclonal antibody targeting GSTK1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 14535-1-AP targets GSTK1 in WB, IHC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, HUVEC cells, Raji cells, L02 cells, mouse testis tissue, rat testis tissue Positive IP detected in: Raji cells Positive IHC detected in: human testis tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information GSTK1, glutathione S-transferase kappa 1, belongs to the superfamily of glutathione S-transferase (GST), which is related to oxidative stress (PMID:16081649). GSTK1 expression is negatively correlated with obesity in mice and human, hypertrophic cardiomyopathy (PMID:21428694, PMID:27378925). GSTK1 was expressed in the peroxisomal and mitochondrial fractions and localized to peroxisomes (PubMed:14742434). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6036 Product name: Recombinant human GSTK1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-226 aa of BC050715 Sequence: MGPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL Predict reactive species Full Name: glutathione S-transferase kappa 1 Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC050715 Gene Symbol: GSTK1 Gene ID (NCBI): 373156 RRID: AB_2115910 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y2Q3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924