Proteintech, 14544-1-AP, PSMB9 Polyclonal antibody

Size: 20ul / 150ul The PSMB9 (14544-1-AP) by Proteintech is a Polyclonal antibody targeting PSMB9 in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 14544-1-AP targets PSMB9 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HL-60 cells, rat spleen tissue, mouse kidney tissue, mouse liver tissue, mouse lung tissue, mouse spleen tissue, rat liver tissue, Raji cells Positive IP detected in: Raji cells Positive IHC detected in: human spleen tissue, human tonsillitis tissue, human renal cell carcinoma tissue, mouse bladder tissue, mouse stomach tissue, rat stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information PSMB9, also named as LMP2, PSMB6i and RING12, belongs to the peptidase T1B family. The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. Replacement of PSMB6 by PSMB9 increases the capacity of the immunoproteasome to cleave model peptides after hydrophobic and basic residues. High expression of PSMB9 associated with the poor prognosis of patients with NPC. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6048 Product name: Recombinant human PSMB9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-219 aa of BC065513 Sequence: MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE Predict reactive species Full Name: proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2) Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 20-23 kDa GenBank Accession Number: BC065513 Gene Symbol: PSMB9 Gene ID (NCBI): 5698 RRID: AB_2268925 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P28065 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.