Iright
BRAND / VENDOR: Proteintech

Proteintech, 14575-1-AP, SDHC Polyclonal antibody

CATALOG NUMBER: 14575-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SDHC (14575-1-AP) by Proteintech is a Polyclonal antibody targeting SDHC in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 14575-1-AP targets SDHC in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, mouse brain tissue, mouse liver tissue, rat liver tissue, mouse heart tissue, mouse kidney tissue, mouse lung tissue Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Background Information SDHC(Succinate dehydrogenase cytochrome b560 subunit, mitochondrial) is also named as CYB560, SDH3 and belongs to the cytochrome b560 family. It is involved in complex II of the mitochondrial electron transport chain and is responsible for transferring electrons from succinate to ubiquinone (coenzyme Q). Defects in SDHC are the cause of paragangliomas type 3 (PGL3) and paraganglioma and gastric stromal sarcoma (PGGSS). It has a transit peptide of 29 amino acid and has 5 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rabbit Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag5775 Product name: Recombinant human SDHC protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-169 aa of BC033626 Sequence: MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYSWSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFALVFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM Predict reactive species Full Name: succinate dehydrogenase complex, subunit C, integral membrane protein, 15kDa Calculated Molecular Weight: 19 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC033626 Gene Symbol: SDHC Gene ID (NCBI): 6391 RRID: AB_2183291 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q99643 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924