Proteintech, 14630-1-AP, RMI1 Polyclonal antibody

Size: 20ul / 150ul The RMI1 (14630-1-AP) by Proteintech is a Polyclonal antibody targeting RMI1 in WB, IP, IHC, ELISA applications with reactivity to human samples 14630-1-AP targets RMI1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, Jurkat cells Positive IP detected in: HeLa cells Positive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:12000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RMI1 is an essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. RMI1 promotes TOP3A binding to double Holliday junctions (DHJ) and hence stimulates TOP3A-mediated dissolution. RMI1 is required for BLM phosphorylation during mitosis. Within the BLM complex, RMI1 is required for BLM and TOP3A stability. (PMID: 16537486, PMID: 16595695, PMID: 15775963) Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6208 Product name: Recombinant human RMI1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC064937 Sequence: MNVTSIALRAETWLLAAWHVKVPPMWLEACINWIQEENNNVNLSQAQMNKQVFEQWLLTDLRDLEHPLLPDGILEIPKGELNGFYALQINSLVDVSQPAHSQIQKLRGKNTTNDLVTAEAQVTPKPWEAKPSRMLMLQLTDGIVQIQGMEYQPIPILHSDLPPGTKILIYGNISFRLGVLLLKPENVKVLGGEVDALLEEYAQEKVLARLIGEPDLVVSVIPNNSNENIPRVTDVLDPALGPSDEELLASLDENDELTANNDTSSERCFTTGSSSNTIPTRQSSFEPEFVISPRPKEEPSNLSIHVMDGELDDFSLEEALLLEETVQKEQMETKELQPLTFNRNADRSIER Predict reactive species Full Name: RMI1, RecQ mediated genome instability 1, homolog (S. cerevisiae) Calculated Molecular Weight: 70 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC064937 Gene Symbol: RMI1 Gene ID (NCBI): 80010 RRID: AB_2301203 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9H9A7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.