Iright
BRAND / VENDOR: Proteintech

Proteintech, 14656-1-AP, LIN7C Polyclonal antibody

CATALOG NUMBER: 14656-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The LIN7C (14656-1-AP) by Proteintech is a Polyclonal antibody targeting LIN7C in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 14656-1-AP targets LIN7C in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: human cerebellum tissue, human brain tissue, human kidney tissue Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6265 Product name: Recombinant human LIN7C protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-197 aa of BC053907 Sequence: MAALGEPVRLERDICRAIELLEKLQRSGEVPPQKLQALQRVLQSEFCNAVREVYEHVYETVDISSSPEVRANATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNIMGGKEQNSPIYISRIIPGGIADRHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGKVKLVVRYTPKVLEEMESRFEKMRSAKRRQQT Predict reactive species Full Name: lin-7 homolog C (C. elegans) Calculated Molecular Weight: 22 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC053907 Gene Symbol: LIN7C Gene ID (NCBI): 55327 RRID: AB_2135197 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9NUP9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924