Proteintech, 14748-1-AP, PSMD2 Polyclonal antibody

Size: 20ul / 150ul The PSMD2 (14748-1-AP) by Proteintech is a Polyclonal antibody targeting PSMD2 in WB, IP, IHC, ELISA applications with reactivity to human, mouse, rat samples 14748-1-AP targets PSMD2 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: SKOV-3 cells, HeLa cells, K-562 cells, human heart tissue, mouse skeletal muscle tissue, PC-3 cells, A431 cells, HL-60 cells, mouse heart tissue, rat heart tissue Positive IP detected in: K-562 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Tumor necrosis factor type 1 receptor-associated protein 2 (TRAP2), encoded by PSMD2 gene, is a non-ATPase regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. TRAP2 may also participate in the TNF signalling pathway since it interacts with the tumor necrosis factor type 1 receptor. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6484 Product name: Recombinant human PSMD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 561-908 aa of BC002368 Sequence: GLGLNHLGKGEAIEAILAALEVVSEPFRSFANTLVDVCAYAGSGNVLKVQQLLHICSEHFDSKEKEEDKDKKEKKDKDKKEAPADMGAHQGVAVLGIALIAMGEEIGAEMALRTFGHLLRYGEPTLRRAVPLALALISVSNPRLNILDTLSKFSHDADPEVSYNSIFAMGMVGSGTNNARLAAMLRQLAQYHAKDPNNLFMVRLAQGLTHLGKGTLTLCPYHSDRQLMSQVAVAGLLTVLVSFLDVRNIILGKSHYVLYGLVAAMQPRMLVTFDEELRPLPVSVRVGQAVDVVGQAGKPKTITGFQTHTTPVLLAHGERAELATEEFLPVTPILEGFVILRKNPNYDL Predict reactive species Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 2 Calculated Molecular Weight: 100 kDa Observed Molecular Weight: 100 kDa GenBank Accession Number: BC002368 Gene Symbol: PSMD2 Gene ID (NCBI): 5708 RRID: AB_2170472 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13200 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.