Proteintech, 14895-1-AP, RBX1 Polyclonal antibody

Size: 20ul / 150ul The RBX1 (14895-1-AP) by Proteintech is a Polyclonal antibody targeting RBX1 in WB, IP, IHC, ELISA applications with reactivity to human samples 14895-1-AP targets RBX1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, Jurkat cells Positive IP detected in: HeLa cells Positive IHC detected in: human heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information RBX1(RING-box protein 1) is also named as RNF75, ROC1 and is a requisite component of the multi- subunit SCF family E3s36-40.It mediates the ubiquitination and subsequent proteasomal degradation of target proteins, including proteins involved in cell cycle progression, signal transduction, transcription and transcription-coupled nucleotide excision repair. Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat, eriocheir sinensis Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6685 Product name: Recombinant human RBX1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-108 aa of BC001466 Sequence: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWEFQKYGH Predict reactive species Full Name: ring-box 1 Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 15 kDa GenBank Accession Number: BC001466 Gene Symbol: RBX1 Gene ID (NCBI): 9978 RRID: AB_2179719 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P62877 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.