Proteintech, 14906-1-AP, FADD Polyclonal antibody

Size: 20ul / 150ul The FADD (14906-1-AP) by Proteintech is a Polyclonal antibody targeting FADD in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse samples 14906-1-AP targets FADD in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HT-1080 cells, mouse pancreas tissue, A549 cells, mouse bone marrow, HeLa cells, HepG2 cells, Jurkat cells Positive IP detected in: A549 cells Positive IHC detected in: human lung cancer tissue, human colon tissue, human cervical cancer tissue, rat kidney tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Fas-Associated protein with Death Domain (FADD), also called MORT1 or GIG3, is encoded by the FADD gene. FADD is an adaptor protein that bridges members of the tumor necrosis factor receptor superfamily, such as the Fas-receptor, to procaspases 8 and 10 to form the death-inducing signaling complex (DISC) during apoptosis. As well as its most well known role in apoptosis, FADD has also been seen to play a role in other processes including proliferation, cell cycle regulation and development. FADD has a calculated molecular mass of 23 kDa and always can be detected as 23-30 kDa (PMID: 15390286, 22864571, 17977957) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, monkey, bovine, sheep Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6701 Product name: Recombinant human FADD protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-208 aa of BC000334 Sequence: MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKLERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAAGAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSGAMSPMSWNSDASTSEAS Predict reactive species Full Name: Fas (TNFRSF6)-associated via death domain Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 23-30 kDa GenBank Accession Number: BC000334 Gene Symbol: FADD Gene ID (NCBI): 8772 RRID: AB_2100486 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13158 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.