Proteintech, 14916-1-AP, DDOST Polyclonal antibody

Size: 20ul / 150ul The DDOST (14916-1-AP) by Proteintech is a Polyclonal antibody targeting DDOST in WB, IHC, IP, ELISA applications with reactivity to human, mouse, rat samples 14916-1-AP targets DDOST in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, mouse pancreas tissue, rat pancreas tissue Positive IP detected in: mouse pancreas tissue Positive IHC detected in: mouse testis tissue, rat small intestine tissue, mouse pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6727 Product name: Recombinant human DDOST protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 92-433 aa of BC002594 Sequence: FLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAF Predict reactive species Full Name: dolichyl-diphosphooligosaccharide-protein glycosyltransferase Calculated Molecular Weight: 49 kDa Observed Molecular Weight: 48 kDa GenBank Accession Number: BC002594 Gene Symbol: DDOST Gene ID (NCBI): 1650 RRID: AB_2230534 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P39656 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.