Iright
BRAND / VENDOR: Proteintech

Proteintech, 14955-1-AP, OAS1/3 Polyclonal antibody

CATALOG NUMBER: 14955-1-AP
السعر العادي$0.99
/
  • ddddd

    99 xxxxxx

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OAS1/3 (14955-1-AP) by Proteintech is a Polyclonal antibody targeting OAS1/3 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 14955-1-AP targets OAS1/3 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: IFN alpha treated HeLa cells, mouse brain tissue Positive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:100-1:400 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information The 2-prime,5-prime oligoadenylate synthetases (OASs), such as OAS1, are interferon-induced proteins characterized by their capacity to catalyze the synthesis of 2-prime,5-prime oligomers of adenosine (2-5As). OAS1 (type I enzymes) has some isoforms with the MW of 40, 42, 44, 46, and 48 kDa (PMID:12590567, 19383565). OAS1 is a strong candidate for determining susceptibility or resistance to viral infections(PMID:15732009). This antibody may have cross-reaction with OAS3 protein due to the high homology. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6793 Product name: Recombinant human OAS1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC000562 Sequence: MMDLRNTPAKSLDKFIEDYLLPDTCFRMQINHAIDIICGFLKERCFRGSSYPVCVSKVVKGGSSGKGTTLRGRSDADLVVFLSPLTTFQDQLNRRGEFIQEIRRQLEACQRERAFSVKFEVQAPRWGNPRALSFVLSSLQLGEGVEFDVLPAFDALGQLTGSYKPNPQIYVKLIEECTDLQKEGEFSTCFTELQRDFLKQRPTKLKSLIRLVKHWYQNCKKKLGKLPPQYALELLTVYAWERGSMKTHFNTAQGFRTVLELVINYQQLCIYWTKYYDFKNPIIEKYLRRQLTKPRPVILDPADPTGNLGGGDPKGWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPA Predict reactive species Full Name: 2',5'-oligoadenylate synthetase 1, 40/46kDa Calculated Molecular Weight: 46 kDa Observed Molecular Weight: ~40 kDa, 100-120 kDa GenBank Accession Number: BC000562 Gene Symbol: OAS1 Gene ID (NCBI): 4938 RRID: AB_2158292 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P00973 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924