Iright
BRAND / VENDOR: Proteintech

Proteintech, 14963-1-AP, SLC25A39 Polyclonal antibody

CATALOG NUMBER: 14963-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SLC25A39 (14963-1-AP) by Proteintech is a Polyclonal antibody targeting SLC25A39 in WB, ELISA applications with reactivity to human, mouse, rat samples 14963-1-AP targets SLC25A39 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information SLC25A39, a member of the mitochondrial carrier family, is a mitochondrial transporter for basic amino acids localized to mitochondria. SLC25A39 can be expressed in human testis, kidney, heart, brain, liver and spleen. It has been reported that SLC25A39 is essential for heme biosynthesis in mammals. SLC25A29 is associated with mitochondrial protein synthesis and amino acid degradation. (PMID: 19656490, 11139402, 24652292) Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag6825 Product name: Recombinant human SLC25A39 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC001398 Sequence: MADQDPAGISPLQQMVASGTGAVVTSLFMTPLDVVKVRLQSQRPSMASELMPSSRLWSLSYTKWKCLLYCNGVLEPLYLCPNGARCATWFQDPTRFTGTMDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGRALTSDLYAPMVAGALARLGTVTVISPLELMRTKLQAQHVSYRELGACVRTAVAQGGWRSLWLGWGPTALRDVPFSALYWFNYELVKSWLNGFRPKDQTSVGMSFVAGGISGTVAAVLTLPFDVVKTQRQVALGAMEAVRVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEFGKSFFQRLNQDRLLGG Predict reactive species Full Name: solute carrier family 25, member 39 Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 37-39 kDa GenBank Accession Number: BC001398 Gene Symbol: SLC25A39 Gene ID (NCBI): 51629 RRID: AB_2878095 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9BZJ4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924