Proteintech, 15047-1-AP, Thymidylate synthase Polyclonal antibody

Size: 20ul / 150ul The Thymidylate synthase (15047-1-AP) by Proteintech is a Polyclonal antibody targeting Thymidylate synthase in WB, IHC, IF/ICC, IP, ELISA applications with reactivity to human, mouse, rat samples 15047-1-AP targets Thymidylate synthase in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293T cells, HEK-293 cells, MCF-7 cells Positive IP detected in: HeLa cells Positive IHC detected in: human endometrial cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:5000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information Thymidylate synthase gene (TYMS) encodes thymidylate synthase (TS) which is an important factor in the growth of tumor cells. TS can catalyze the transformation of intracellular uridine monophosphate (dump) into dTMP which is required for DNA replication and repairing. TS is a key enzyme in the process of cell proliferation, also is the important target enzymes of 5-FU and other chemotherapy drugs. The expression of TYMS is negatively correlated with the efficacy of chemotherapy and the prognosis of patients who suffer from rectal cancer, breast cancer, colorectal cancer, gastric cancer, head and neck cancer, esophageal cancer, pancreatic cancer and so on. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7027 Product name: Recombinant human TYMS protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-313 aa of BC002567 Sequence: MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKDDRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGSTNAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGAEYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMALPPCHALCQFYVVNSELSCQLYQRSGDMGLGVPFNIASYALLTYMIAHITGLKPGDFIHTLGDAHIYLNHIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV Predict reactive species Full Name: thymidylate synthetase Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 32-36 kDa GenBank Accession Number: BC002567 Gene Symbol: TYMS Gene ID (NCBI): 7298 RRID: AB_2210721 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P04818 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.