Proteintech, 15154-1-AP, PSMB2 Polyclonal antibody

Size: 20ul / 150ul The PSMB2 (15154-1-AP) by Proteintech is a Polyclonal antibody targeting PSMB2 in WB, IF/ICC, ELISA applications with reactivity to human samples 15154-1-AP targets PSMB2 in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells, HEK-293 cells, HeLa cells, Jurkat cells Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information PSMB2, Proteasome subunit beta type-2, is also known as 20S proteasome subunit beta-4(PMID: 7918633). The proteasome is responsible for degradation of short lived and misfolded cytosolic and nuclear proteins in the cell and cleaves peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. PSMB2 is up-regulated in ovarian cancer cell lines. The up-regulation of PSMB2 may indicate the activated neuronal defensive mechanism in VAD (vitamin A depletion) brain regions (PMID: 21190828). Knockdown of PSMB2 suppresses hepatocellular carcinoma and gastric cancer cell proliferation and invasion (PMID: 29780166, PMID: 36110152). Specification Tested Reactivity: human Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag7198 Product name: Recombinant human PSMB2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-201 aa of BC000268 Sequence: MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS Predict reactive species Full Name: proteasome (prosome, macropain) subunit, beta type, 2 Calculated Molecular Weight: 23 kDa Observed Molecular Weight: 23 kDa GenBank Accession Number: BC000268 Gene Symbol: PSMB2 Gene ID (NCBI): 5690 RRID: AB_2300322 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49721 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.